PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C005072P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 296aa    MW: 31212.6 Da    PI: 6.7995
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C005072P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.41e-101255445
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     W+ e d+ + +a + ++ +   +W++Ia  ++ g+t +++k+++ 
   MELO3C005072P1 12 WSLEQDKAFENALASHPEDdsdRWEKIAVDVP-GKTVEEIKHHYE 55
                     ********************************.**********96 PP

2Myb_DNA-binding422.2e-13122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   MELO3C005072P1 122 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.339762IPR017884SANT domain
SMARTSM007175.1E-9860IPR001005SANT/Myb domain
SuperFamilySSF466894.02E-101066IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.0E-41155IPR009057Homeodomain-like
CDDcd001675.46E-91258No hitNo description
PfamPF002492.1E-81255IPR001005SANT/Myb domain
PROSITE profilePS5129417.641114171IPR017930Myb domain
SuperFamilySSF466892.62E-16118172IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-17119169IPR006447Myb domain, plants
SMARTSM007173.2E-10119169IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-10122165IPR009057Homeodomain-like
PfamPF002492.7E-11122166IPR001005SANT/Myb domain
CDDcd001678.38E-10122167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MTVDEAGSSS LWSLEQDKAF ENALASHPED DSDRWEKIAV DVPGKTVEEI KHHYELLVED  60
VNLIESGCVP LPSYSSSSDG SANHAGDEGT TKKNGHFGNC NGDSNHGSKT SRSDQEHRKG  120
IAWTEDEHRL FLLGLDKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKERRRS  180
SIHDITSVAN GDISATQGPI TGQANGSGAA PSGKPTKQPP QSAAGPPGVG MYGGPTMGQP  240
VGGPLVSAVG TPVSLPAPAH MAYGVRAPVP GTVVPGAPVN MGPMTYPMPP TSAHR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-18777676RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818950.0LN681895.1 Cucumis melo genomic scaffold, anchoredscaffold00005.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008465139.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008465150.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008465157.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008465164.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008465173.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008465180.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_008465185.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H76e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0A0KTA80.0A0A0A0KTA8_CUCSA; Uncharacterized protein
STRINGGLYMA07G28310.11e-169(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-114MYB family protein